Custrd is out on the App Store — Download it free →
Back to recipes

15-Min Cinnamon Sugar Churros with Hot Chocolate

Crispy-outside, pillowy-inside churros piped straight into hot oil, tossed in cinnamon sugar, and served with silky melted chocolate for dipping. Restaurant-quality in 15 minutes, no fancy equipment needed.

Total time
15 min
Servings
4
Calories
420
Protein
5g
15-Min Cinnamon Sugar Churros with Hot Chocolate
indulgentsimplespanishvegetariancrispyfluffydessertweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour with 2 tbsp sugar, a pinch of salt, and 1 tsp cinnamon in a bowl. Add 1 cup boiling water slowly, stirring until a thick paste forms.

  2. Step 2

    Heat oil in a heavy pot to 375°F (use a thermometer). Transfer dough to a churrera or piping bag fitted with a large star tip.

  3. Step 3

    Carefully pipe 4-inch lengths of dough directly into hot oil in batches—they'll float and brown in 1.5-2 minutes per side.

  4. Step 4

    Remove churros with a slotted spoon and drain on paper towels. Toss immediately with remaining 1 tbsp sugar and 0.5 tsp cinnamon.

  5. Step 5

    Heat chocolate and cream in a small pot over low heat, stirring until smooth and pourable.

  6. Step 6

    Serve churros warm with chocolate dip alongside.

Tools you’ll need

  • medium bowl
  • heavy pot (at least 3 quarts)
  • candy / frying thermometer
  • churrera or large star-tip piping bag
  • slotted spoon
  • paper towels
  • small pot for chocolate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.