CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Min Cinnamon Sugar Churros with Hot Chocolate

Crispy-outside, pillowy-inside churros piped straight into hot oil, tossed in cinnamon sugar, and served with silky melted chocolate for dipping. Restaurant-quality in 15 minutes, no fancy equipment needed.

Total time
15 min
Servings
4
Calories
420
Protein
5g
15-Min Cinnamon Sugar Churros with Hot Chocolate
indulgentsimplespanishvegetariancrispyfluffydessertweeknight

Ingredients

  • 1.25 cups all-purpose flour
  • 3 tbsp granulated sugar
  • 1.5 tsp ground cinnamon
  • 4 oz whole milk dark chocolate (chopped)
  • ½ cup heavy cream
  • 1.5 quarts neutral oil (for frying)

Instructions

  1. 1

    Mix flour with 2 tbsp sugar, a pinch of salt, and 1 tsp cinnamon in a bowl. Add 1 cup boiling water slowly, stirring until a thick paste forms.

  2. 2

    Heat oil in a heavy pot to 375°F (use a thermometer). Transfer dough to a churrera or piping bag fitted with a large star tip.

  3. 3

    Carefully pipe 4-inch lengths of dough directly into hot oil in batches—they'll float and brown in 1.5-2 minutes per side.

  4. 4

    Remove churros with a slotted spoon and drain on paper towels. Toss immediately with remaining 1 tbsp sugar and 0.5 tsp cinnamon.

  5. 5

    Heat chocolate and cream in a small pot over low heat, stirring until smooth and pourable.

  6. 6

    Serve churros warm with chocolate dip alongside.

Tools you’ll need

  • medium bowl
  • heavy pot (at least 3 quarts)
  • candy / frying thermometer
  • churrera or large star-tip piping bag
  • slotted spoon
  • paper towels
  • small pot for chocolate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Spanish recipes →