Custrd is out on the App Store — Download it free →
Back to recipes

Chilled Somen with Ginger & Snap Peas

Ultra-fresh Japanese somen noodles served ice-cold with a light dipping sauce, pickled ginger, and crisp snap peas. Ready in 15 minutes—pure summer comfort.

Total time
15 min
Servings
2
Calories
245
Protein
7g
Chilled Somen with Ginger & Snap Peas
lightrefreshingjapanesevegetarianvegantendercrispyweeknight

Ingredients

  • 6 oz somen noodles (dried)
  • 1 cup dashi stock or water
  • 3 tbsp soy sauce
  • 1.5 tbsp mirin
  • ¼ cup pickled ginger (gari)
  • ¾ cup fresh snap peas

Instructions

  1. 1

    Bring a pot of salted water to boil. Add somen noodles and cook until just tender, ~3 minutes.

  2. 2

    Drain noodles and rinse under ice-cold water until completely cool, stirring gently with chopsticks.

  3. 3

    Stir dashi, soy sauce, and mirin in a bowl until sugar dissolves. Divide between two small dipping bowls.

  4. 4

    Arrange noodles on a chilled plate or serving dish. Top with pickled ginger and snap peas.

  5. 5

    Serve noodles with ice cubes alongside the dipping sauce. Dip bites of noodles and vegetables into sauce.

Tools you’ll need

  • large pot
  • colander
  • small bowls (2)
  • serving plate
  • chopsticks or fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.