CookSnap is coming soon — Join the waitlist →
Back to recipes

Chilaquiles con Cecina

Crispy tortilla strips tossed in a vibrant red chile sauce with tender shredded cecina, topped with cheese and fresh garnishes. A classic Mexican comfort dish ready in under 45 minutes.

Total time
40 min
Servings
2
Calories
520
Protein
26g
Chilaquiles con Cecina
comfortsatisfyingmexicanbeefcrispytendercreamyweeknight

Ingredients

  • ½ lb cecina (dried salted beef), thinly sliced
  • 6 count corn tortillas
  • 4 count dried red chiles (guajillo or chile de árbol), seeds and stems removed
  • 2 count garlic cloves
  • 1 cup chicken or vegetable broth
  • ½ cup queso fresco or cotija cheese, crumbled
  • ½ count white onion, thinly sliced
  • ¼ cup fresh cilantro, roughly chopped

Instructions

  1. 1

    Hold each chile over an open flame on your stove or under the broiler, turning every 2 seconds, until the skin darkens and becomes fragrant, about 8–10 seconds per side—do not let it burn completely.

  2. 2

    Place the roasted chiles in a small bowl and pour 1 cup hot water over them; let soak for 5 minutes until softened, then drain, discarding the soaking water.

  3. 3

    Stack the tortillas, then cut them in half, then cut each half into 3 strips, creating roughly triangular pieces about 2 inches long—set aside.

  4. 4

    Lay the cecina slices on a plate and separate them gently with your fingers into loose shreds, breaking any clumps apart.

  5. 5

    Place the softened chiles and garlic cloves in a blender, add 1 cup broth, and blend on high speed for 45 seconds until completely smooth with no visible chile bits remaining.

  6. 6

    Pour the chile sauce through a fine-mesh strainer into a small bowl, pressing gently with the back of a spoon to extract all liquid; discard any solids.

  7. 7

    Heat 2 tablespoons olive oil in a large 10-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  8. 8

    Add the tortilla strips to the hot oil in a single layer and fry, stirring every 30 seconds with a wooden spoon, until the edges turn golden-brown and crispy, about 4–5 minutes total.

  9. 9

    Pour the strained chile sauce over the hot tortilla strips and stir constantly with a wooden spoon for 30 seconds until the chips are evenly coated.

  10. 10

    Scatter the shredded cecina over the top and stir gently for 20 seconds, mixing it into the chilaquiles without breaking the chips into tiny pieces.

  11. 11

    Remove the skillet from heat and let sit undisturbed for 1 minute so the chips absorb some sauce but stay slightly crispy.

  12. 12

    Sprinkle the crumbled queso fresco and chopped cilantro evenly over the top, scatter the sliced onion in a thin layer, and serve immediately directly from the skillet.

Tools you’ll need

  • 10-inch skillet
  • blender
  • fine-mesh strainer
  • wooden spoon
  • small bowl
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.