Custrd is out on the App Store — Download it free →
Back to recipes

Chickpea Fritter Sandwich

Crispy golden chickpea fritters tucked into soft bread with a sprinkle of curry powder and fresh herbs. A quick, satisfying sandwich that's perfect for lunch or a light dinner.

Total time
30 min
Servings
2
Calories
420
Protein
12g
Chickpea Fritter Sandwich
comfortingmediterraneanveganvegetarianchickpeacrispysoftweeknight

Ingredients

  • 1 cup chickpea flour
  • 1 cup water
  • 3 tbsp olive oil
  • 1 tsp curry powder
  • ½ tsp salt
  • 4 slices bread
  • ¼ cup fresh herbs (like parsley or cilantro)

Instructions

  1. 1

    In a bowl, whisk together 1 cup chickpea flour, 1 cup water, 1 tsp curry powder, and 0.5 tsp salt until smooth. Let rest for 10 minutes.

  2. 2

    Heat 2 tbsp olive oil in a non-stick skillet over medium heat. Pour in the batter to form 4 small fritters, about 3 inches wide.

  3. 3

    Cook fritters until edges are golden and set, about 4 minutes. Flip and cook until golden and crisp on both sides, about 4 more minutes.

  4. 4

    Toast 4 slices of bread until lightly golden. Drizzle with remaining 1 tbsp olive oil.

  5. 5

    Place fritters on bread, sprinkle with 0.25 cup fresh herbs, and top with remaining bread. Serve warm.

Tools you’ll need

  • mixing bowl
  • whisk
  • non-stick skillet
  • spatula
  • toaster or oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.