CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Chicken Salteña Empanadas

Hand-held Bolivian pastry pockets filled with spiced chicken, potatoes, and olives, baked until golden. A weeknight shortcut using store-bought wonton wrappers instead of homemade dough—ready in under 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
18g
20-Min Chicken Salteña Empanadas
casualsatisfyingbolivianchickencrispytenderflakyweeknight

Ingredients

  • 1.5 cups rotisserie or cooked chicken, shredded
  • 1 medium potato, diced small (1/4-inch)
  • ½ cup green olives, chopped
  • ¼ cup yellow onion, minced
  • 2 tbsp aji amarillo paste (or 1 tsp cumin + 0.5 tsp cayenne)
  • 24 count wonton or dumpling wrappers
  • 1 count egg, beaten (for brushing)

Instructions

  1. 1

    Microwave diced potato with 2 tbsp water, covered, for 3 minutes until just tender. Drain and cool slightly.

  2. 2

    Mix cooked potato, shredded chicken, olives, minced onion, and aji amarillo paste in a bowl. Season with salt and pepper.

  3. 3

    Lay a wonton wrapper on a dry surface. Place 1 heaping tbsp filling in the center, leaving a 0.5-inch border.

  4. 4

    Brush borders with beaten egg. Fold wrapper in half diagonally to form a triangle, then press edges firmly to seal.

  5. 5

    Place sealed empanadas seam-side up on a parchment-lined baking sheet. Brush tops with remaining egg wash.

  6. 6

    Bake at 400°F for 10–12 minutes until golden brown and crispy on edges. Serve hot with hot sauce or aji.

Tools you’ll need

  • microwave-safe bowl
  • mixing bowl
  • baking sheet
  • parchment paper
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.