CookSnap is coming soon — Join the waitlist →
Back to recipes

Chicken Salteña Pockets

Buttery, crispy hand pies filled with spiced chicken, potatoes, and olives—Bolivia's beloved street snack, streamlined for a weeknight. Baked in 20 minutes, served warm with hot sauce.

Total time
25 min
Servings
4
Calories
385
Protein
18g
Chicken Salteña Pockets
casualsatisfyingbolivianchickencrispytenderflakyweeknight

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • 1 package frozen empanada or pie dough sheets (9 oz total)
  • ¾ cup potato, diced small
  • ¼ cup red onion, minced
  • ⅓ cup green olives, chopped
  • 2 tbsp aji or hot sauce (or 1 tsp cayenne + 1 tbsp tomato paste)
  • ¾ tsp cumin
  • 1 whole egg, beaten (for egg wash)

Instructions

  1. 1

    Microwave diced potato with 2 tbsp water, covered, for 4 minutes until just tender. Drain well.

  2. 2

    Mix shredded chicken, cooked potato, red onion, olives, aji, and cumin in a bowl until combined.

  3. 3

    Thaw empanada dough sheets per package (usually 5 min at room temp). Preheat oven to 400°F.

  4. 4

    Divide filling among dough sheets. Fold each into a half-moon, press edges to seal, then crimp with a fork.

  5. 5

    Place on a parchment-lined sheet pan. Brush tops with beaten egg. Bake for 12 minutes until golden brown.

  6. 6

    Let cool 2 minutes. Serve warm with hot sauce on the side.

Tools you’ll need

  • microwave
  • mixing bowl
  • sheet pan
  • parchment paper
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.