CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chicken Parmesan

Crispy-breaded chicken topped with warm marinara and melted mozzarella. Baked until golden and bubbly—ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
412
Protein
38g
Chicken Parmesan
comfortsatisfyingitalianchickencrispytendermeltyweeknight

Ingredients

  • 2 4-oz fillets chicken breast
  • ⅓ cup all-purpose flour
  • 1 large egg
  • ¾ cup panko breadcrumbs
  • 1 cup marinara sauce
  • ¾ cup mozzarella cheese, shredded

Instructions

  1. 1

    Preheat oven to 400°F. Line a baking sheet with foil.

  2. 2

    Pound chicken to 1/2-inch thickness between plastic wrap using a meat mallet or heavy pan.

  3. 3

    Set up three shallow bowls: flour in one, beaten egg in the second, panko mixed with salt and pepper in the third.

  4. 4

    Coat each chicken breast in flour, shaking off excess. Dip in egg, then press into panko until fully coated.

  5. 5

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, ~90 seconds.

  6. 6

    Sear chicken 3 minutes per side without moving until golden brown. Transfer to the prepared baking sheet.

  7. 7

    Spoon 2 tbsp marinara over each chicken breast. Top with 3 tbsp mozzarella per piece.

  8. 8

    Bake 8 to 10 minutes until cheese melts and edges bubble slightly.

  9. 9

    Serve immediately with remaining warm marinara on the side.

Tools you’ll need

  • baking sheet
  • foil
  • meat mallet or heavy skillet
  • plastic wrap
  • three shallow bowls
  • 12-inch skillet
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.