CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chicken Milanese

Thin, tender chicken breast pounded flat, breaded, and pan-fried until golden and crispy—ready in 20 minutes. Serve with lemon wedges for an authentic Italian classic.

Total time
20 min
Servings
2
Calories
485
Protein
42g
Chicken Milanese
simpleelegantitalianchickencrispytenderweeknightmain-dish

Ingredients

  • 2 breasts (about 6 oz each) boneless, skinless chicken breasts
  • ½ cup all-purpose flour
  • 1 large eggs
  • ¾ cup panko breadcrumbs
  • 3 tablespoons olive oil
  • 1 portion salt and pepper to taste
  • 1 whole lemon

Instructions

  1. 1

    Place one chicken breast on a cutting board, then cover it with plastic wrap or a clean kitchen towel.

  2. 2

    Using a meat mallet, rolling pin, or the bottom of a heavy skillet, pound the chicken flat by striking it firmly and repeatedly until it is about 1/4 inch thick all over—the thickness of a coin.

  3. 3

    Repeat steps 1 and 2 with the second chicken breast, then remove and set both aside on a clean plate.

  4. 4

    Pour the flour into a shallow bowl, the panko breadcrumbs into a second shallow bowl, and whisk the egg with 1 tablespoon of water in a third shallow bowl until uniform.

  5. 5

    Sprinkle both sides of each pounded chicken breast lightly with salt and pepper.

  6. 6

    Dredge one chicken breast in the flour bowl, coating both sides and shaking off excess, then lay it on a clean plate.

  7. 7

    Dip the floured chicken into the egg mixture, coating both sides and letting excess drip off, then place it back on the clean plate.

  8. 8

    Press both sides of the egg-coated chicken firmly into the panko breadcrumbs, ensuring they stick evenly, then set it aside on a fresh plate.

  9. 9

    Repeat steps 6, 7, and 8 with the second chicken breast until both are fully breaded.

  10. 10

    Heat the olive oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  11. 11

    Carefully lay one breaded chicken breast into the hot oil—you should hear a steady sizzle—and cook without moving it for 3 minutes until the bottom is golden brown and crispy like the color of caramel.

  12. 12

    Flip the chicken using tongs or a spatula and cook the second side for 2 to 3 minutes until it is also golden brown and the thickest part registers 165°F on a meat thermometer.

  13. 13

    Transfer the cooked chicken to a clean plate and repeat steps 11 and 12 with the remaining breaded breast.

  14. 14

    Cut the lemon lengthwise into two halves, then cut each half crosswise into two wedges.

  15. 15

    Divide both chicken breasts between two plates and place one lemon wedge on each plate for squeezing over the chicken.

Tools you’ll need

  • cutting board
  • meat mallet or rolling pin
  • three shallow bowls
  • whisk
  • clean plates
  • 12-inch stainless steel or cast iron skillet
  • tongs or spatula
  • meat thermometer
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.