CookSnap is coming soon — Join the waitlist →

Chicken Jalfrezi

A vibrant Indian stir-fry with tender chicken, bell peppers, and tomatoes in a tangy, spiced sauce. Quick, aromatic, and perfect served over rice or with naan.

Total time
35 min
Servings
4
Calories
285
Protein
35g
Chicken Jalfrezi
indianchickenstir-fryspicyweeknight dinnertomato-based

Ingredients

  • 1.25 lbs boneless, skinless chicken breasts
  • 3 tbsp vegetable oil
  • 2 medium onions, sliced
  • 4 cloves garlic cloves, minced
  • 1 tbsp ginger, grated
  • 2 whole green chillies, sliced
  • 1 large red bell pepper, sliced
  • 1 large green bell pepper, sliced
  • ¾ cup tomato puree
  • 1.5 tsp coriander powder
  • 1 tsp cumin powder
  • ½ tsp turmeric powder
  • 1 tsp Kashmiri chilli powder
  • ¾ tsp garam masala
  • 1 tsp salt
  • ½ tsp black pepper
  • 2 tbsp tomato ketchup
  • 1.5 tbsp lemon juice
  • ¼ cup water
  • 3 tbsp fresh coriander, chopped

Instructions

  1. 1

    Cut chicken breasts into 1-inch cubes and set aside.

  2. 2

    Slice onions, bell peppers, and green chillies. Mince garlic and grate ginger. Set all aside.

  3. 3

    In a small bowl, mix coriander powder, cumin, turmeric, Kashmiri chilli powder, and garam masala.

  4. 4

    Heat oil in a large wok or 12-inch skillet over medium-high heat. Add chicken pieces and cook 5-6 minutes until lightly golden on edges. Remove and set aside.

  5. 5

    In the same skillet, add sliced onions and sauté 3-4 minutes until soft and light golden.

  6. 6

    Add minced garlic, ginger, and green chillies. Cook 1-2 minutes, stirring constantly, until fragrant.

  7. 7

    Add the spice mixture (coriander, cumin, turmeric, chilli powder, garam masala) and stir for 30 seconds to bloom.

  8. 8

    Add tomato puree, ketchup, salt, and black pepper. Stir well and cook 2-3 minutes on medium heat.

  9. 9

    Return the cooked chicken to the skillet. Add water and stir to coat with sauce. Simmer 5-6 minutes until chicken is cooked through.

  10. 10

    Add sliced bell peppers and cook 3-4 minutes until tender-crisp, stirring occasionally.

  11. 11

    Finish with lemon juice and taste for seasoning, adjusting salt and spices as needed.

  12. 12

    Garnish with fresh coriander and serve hot with rice or naan.

Tools you’ll need

  • 12-inch wok or large skillet
  • cutting board
  • sharp knife
  • small mixing bowl
  • wooden spoon or spatula
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.