CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Kung Pao Chicken

A classic Sichuan dish with tender chicken, roasted peanuts, and dried chilies in a savory-sweet sauce. Quick to prepare and bursting with bold, spicy flavor.

Total time
25 min
Servings
4
Calories
420
Protein
45g
Kung Pao Chicken
chinesesichuanchickenspicystir-fryweeknight dinner

Ingredients

  • 1.5 lbs boneless skinless chicken breasts
  • ¾ cup roasted unsalted peanuts
  • 6 whole dried red chilies
  • 3 tbsp vegetable oil
  • 3 clove garlic cloves, minced
  • 1 tbsp fresh ginger, minced
  • 4 whole green onions, cut into 1-inch pieces
  • 3 tbsp soy sauce
  • 1.5 tbsp rice vinegar
  • 1 tbsp sugar
  • ½ tsp sesame oil
  • 1 tbsp cornstarch
  • ¼ cup water

Instructions

  1. 1

    Cut chicken breasts into 0.75-inch cubes. Set aside.

  2. 2

    Whisk together soy sauce, rice vinegar, sugar, sesame oil, cornstarch, and water in a small bowl. Set sauce aside.

  3. 3

    Remove seeds from dried chilies (optional, for less heat) and cut into 1-inch pieces.

  4. 4

    Heat 1.5 tbsp vegetable oil in a 14-inch wok or large skillet over high heat until shimmering.

  5. 5

    Add chicken cubes and stir-fry until golden on all sides and cooked through, 6-8 minutes. Transfer to a plate.

  6. 6

    Add remaining 1.5 tbsp oil to the wok. Add dried chilies and toast for 30 seconds until fragrant.

  7. 7

    Add garlic and ginger, stir-fry for 30 seconds until fragrant.

  8. 8

    Return chicken to the wok. Add peanuts and green onions.

  9. 9

    Pour in sauce and toss everything together over high heat for 1-2 minutes until sauce thickens and coats all ingredients.

  10. 10

    Transfer to serving bowl and serve immediately over steamed rice.

Tools you’ll need

  • 14-inch wok or large skillet
  • cutting board
  • chef's knife
  • small mixing bowl
  • wooden spoon or wok spatula
  • serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.