CookSnap is coming soon — Join the waitlist →
Back to recipes

Charred Veg & Farro Bowl

Pearl farro gets tender while vegetables char in one pan, then tossed with lemon and fresh herbs. Nutty, bright, and fully done in under 25 minutes.

Total time
25 min
Servings
2
Calories
380
Protein
13g
Charred Veg & Farro Bowl
wholesomefreshitalianvegetarianveganvegetariantendercrispy

Ingredients

  • 1 cup pearl farro
  • 1 medium zucchini
  • 1 large red bell pepper
  • ½ medium red onion
  • 1.5 cups cherry tomatoes
  • 1 whole lemon
  • ⅓ cup fresh herbs (parsley or basil, chopped)

Instructions

  1. 1

    Bring 2.5 cups salted water to a boil. Add farro and cook until tender but chewy, ~18 minutes.

  2. 2

    While farro cooks, cut zucchini into 1-inch rounds, quarter the pepper, cut onion into thick wedges, halve the tomatoes.

  3. 3

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering. Add all vegetables and a pinch of salt.

  4. 4

    Sear without stirring for 4 minutes until edges brown, then toss and cook 3 minutes more until charred and tender.

  5. 5

    Drain farro. Add to the skillet with the vegetables and squeeze half a lemon over the top.

  6. 6

    Toss everything together. Taste and adjust with salt, pepper, and remaining lemon juice. Top with fresh herbs.

Tools you’ll need

  • pot for boiling farro
  • large skillet (12-inch)
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.