CookSnap is coming soon — Join the waitlist →

Charred Beef Kebab Bowl with Tahini

Seasoned ground beef skewers with grilled peppers, onions, avocado, and crisp greens, topped with tahini drizzle. Ready in 25 minutes on one sheet pan.

Total time
25 min
Servings
2
Calories
580
Protein
42g
Charred Beef Kebab Bowl with Tahini
satisfyingfreshisraelibeefcrispytendercreamyweeknight

Ingredients

  • 1 lb ground beef
  • 2 medium bell peppers (red or yellow), cut into 1-inch pieces
  • 1 medium red onion, cut into 1-inch chunks
  • ¼ cup tahini
  • 1 whole lemon (juiced)
  • 1 whole avocado, sliced
  • 2 cups fresh greens (arugula or mixed)
  • 1 tsp cumin

Instructions

  1. 1

    Mix ground beef with cumin, 1 tsp salt, and 0.5 tsp pepper. Divide into 2 portions and mold onto metal skewers into long, flat patties.

  2. 2

    Toss peppers and onion with 2 tbsp oil, salt, and pepper. Spread on a sheet pan with the beef skewers.

  3. 3

    Broil 4 inches from heat for 12–15 minutes, stirring vegetables halfway, until beef is charred and cooked through.

  4. 4

    While kebabs cook, whisk tahini with lemon juice, 3 tbsp water, 0.5 tsp salt, and minced garlic until smooth and pourable.

  5. 5

    Divide greens between two bowls. Top with beef skewers, grilled vegetables, and avocado slices.

  6. 6

    Drizzle tahini sauce over the top. Serve immediately.

Tools you’ll need

  • two metal skewers
  • sheet pan
  • broiler
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.