CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Cast Iron Skillet Cornbread

Golden, slightly sweet cornbread baked in a cast iron skillet with a crispy crust. Perfect alongside chili, soup, or as a standalone snack with honey butter.

Total time
30 min
Servings
8
Calories
165
Protein
3g
Cast Iron Skillet Cornbread
comfortsimpleamericanvegetariancrispytenderfluffyMain course

Ingredients

  • 3 tbsp butter
  • 1 cup cornmeal (yellow or white)
  • 1 cup all-purpose flour
  • 2 tbsp granulated sugar
  • 1.5 tsp baking powder
  • ½ tsp salt
  • 1 cup whole milk
  • 1 whole large egg

Instructions

  1. 1

    Preheat oven to 425°F. Place a 10-inch cast iron skillet in the oven.

  2. 2

    Whisk together cornmeal, flour, sugar, baking powder, and salt in a large bowl.

  3. 3

    Whisk milk and egg together in a separate bowl until combined.

  4. 4

    Stir milk mixture into cornmeal mixture until just combined—don't overmix.

  5. 5

    Carefully remove hot skillet from oven. Add 3 tbsp butter and swirl to coat.

  6. 6

    Pour batter into the hot skillet. Bake 18–22 minutes until golden brown and a toothpick inserted in the center comes out clean.

  7. 7

    Cool in the skillet for 5 minutes, then turn out onto a cutting board.

Tools you’ll need

  • 10-inch cast iron skillet
  • oven
  • large mixing bowl
  • small bowl
  • whisk
  • measuring cups and spoons
  • toothpick

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.