Custrd is out on the App Store — Download it free →
Back to recipes

Carbonara Risotto

A creamy, comforting risotto with crispy bacon and a rich egg and cheese finish, inspired by classic carbonara flavors.

Total time
35 min
Servings
4
Calories
480
Protein
18g
Carbonara Risotto
comfortingItalianporkcreamycrispyweeknightmaindinner

Ingredients

  • 1.5 cups arborio rice
  • 6 slices bacon
  • 1 medium onion
  • 4 cups chicken broth
  • 2 large eggs
  • ½ cup parmesan cheese
  • 1 tbsp olive oil
  • ½ tsp black pepper

Instructions

  1. 1

    In a large skillet, cook the 6 slices bacon over medium heat until crispy, about 8 minutes. Transfer to a paper towel-lined plate, leaving 1 tbsp drippings in the pan.

  2. 2

    Add the 1 tbsp olive oil and 1 diced onion to the skillet. Cook over medium until soft and translucent, about 5 minutes.

  3. 3

    Stir in the 1.5 cups arborio rice and toast for 2 minutes, stirring constantly, until the edges turn translucent.

  4. 4

    Add 1 cup of the 4 cups chicken broth, stirring until absorbed. Continue adding broth 1 cup at a time, stirring frequently, until the rice is creamy and tender, about 20 minutes total.

  5. 5

    In a bowl, whisk the 2 eggs with the 0.5 cup grated parmesan and 0.5 tsp black pepper.

  6. 6

    Remove the risotto from heat. Quickly stir in the egg mixture and crumbled bacon until creamy and thick. Serve immediately with extra parmesan if desired.

  7. 7

    Let the risotto rest for 2 minutes before serving to allow the sauce to set.

Tools you’ll need

  • Large skillet
  • Wooden spoon
  • Mixing bowl
  • Whisk
  • Measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.