CookSnap is coming soon — Join the waitlist →

15-Min Cajun Shrimp Tacos with Crema

Blackened shrimp hits a warm tortilla with tangy crema slaw and a sprinkle of crispy Cajun spice. Fast enough for a weeknight snack, impressive enough to serve.

Total time
12 min
Servings
2
Calories
380
Protein
28g
15-Min Cajun Shrimp Tacos with Crema
quicksatisfyingcajunshrimpcrispytendercreamyweeknight

Ingredients

  • ¾ lb large shrimp, peeled and deveined
  • 2 tbsp Cajun seasoning
  • ½ cup sour cream
  • 2 cups coleslaw mix (pre-shredded cabbage)
  • 1 whole lime (juiced)
  • 4 count flour tortillas (6-inch)

Instructions

  1. 1

    Mix sour cream with half the lime juice and a pinch of salt. Toss coleslaw mix with the crema until coated.

  2. 2

    Pat shrimp dry. Toss with Cajun seasoning and the remaining lime juice until evenly coated.

  3. 3

    Heat oil in a large skillet over medium-high until it shimmers. Working in one batch, sear shrimp 90 seconds per side without moving — edges should turn opaque.

  4. 4

    Warm tortillas in the same skillet for 10 seconds per side, stacking them as they finish.

  5. 5

    Divide crema slaw among tortillas. Top with shrimp and serve with tortilla chips on the side.

Tools you’ll need

  • 12-inch skillet
  • small mixing bowl
  • tongs
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.