CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Cajun Shrimp and Grits

Creamy stone-ground grits topped with spicy, garlicky shrimp in a rich Cajun sauce. A Louisiana classic that tastes restaurant-quality but cooks in under 45 minutes.

Total time
45 min
Servings
4
Calories
520
Protein
38g
Cajun Shrimp and Grits
comfortindulgentcajunshrimpcreamytenderweeknightdate-night

Ingredients

  • 1 cup stone-ground cornmeal (polenta)
  • 4 cups chicken broth
  • 4 tbsp butter
  • 1 cup sharp cheddar, grated
  • 1.5 lbs large shrimp, peeled and deveined
  • 4 cloves garlic, minced
  • 2 tsp Cajun seasoning (store-bought)
  • ½ tsp smoked paprika
  • 2 tbsp lemon juice

Instructions

  1. 1

    Heat 4 cups chicken broth in a large pot over medium-high until it boils.

  2. 2

    Slowly whisk in cornmeal, stirring constantly to prevent lumps, then reduce heat to low.

  3. 3

    Stir every 2 minutes for 15 minutes until grits are thick and creamy.

  4. 4

    Remove from heat. Stir in 4 tbsp butter and 1 cup cheddar until fully melted.

  5. 5

    Heat 2 tbsp olive oil in a large skillet over medium-high until it shimmers.

  6. 6

    Add 4 cloves minced garlic and cook, stirring, until fragrant, about 30 seconds.

  7. 7

    Add shrimp, 2 tsp Cajun seasoning, and 0.5 tsp smoked paprika. Cook 2 minutes without stirring.

  8. 8

    Stir shrimp and cook 1–2 more minutes until pink throughout and just cooked.

  9. 9

    Finish with 2 tbsp lemon juice and stir to combine.

  10. 10

    Spoon creamy grits into bowls and top with shrimp and pan sauce.

Tools you’ll need

  • large pot
  • whisk
  • wooden spoon
  • 12-inch skillet
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.