Custrd is out on the App Store — Download it free →
Back to recipes

15-Min Cajun Chicken Alfredo

Creamy cajun pasta with seared chicken, garlic, and a spicy kick — ready in under 10 minutes using store-bought alfredo as the base. One skillet, bold flavor, zero fuss.

Total time
15 min
Servings
2
Calories
625
Protein
38g
15-Min Cajun Chicken Alfredo
comfortquickcajunchickencreamytenderweeknightpasta

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet, add pasta, and cook until al dente, ~8 minutes.

  2. Step 2

    Reserve 1 cup pasta water, then drain the pasta. Do not rinse.

  3. Step 3

    Return skillet to medium-high heat. Add chicken and cajun seasoning; sear until no pink remains, ~5 minutes, stirring often.

  4. Step 4

    Add minced garlic and red pepper flakes; cook until fragrant, ~30 seconds.

  5. Step 5

    Pour in alfredo sauce and return cooked pasta to the skillet. Toss until coated; add pasta water a splash at a time if too thick.

  6. Step 6

    Taste and adjust seasoning. Serve hot.

Tools you’ll need

  • large skillet with lid
  • wooden spoon
  • colander or fine strainer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.