Café-Style Latte at Home
Silky espresso and steamed milk with café-quality microfoam — no machine needed. Steam milk in a small pot, pour over espresso, and finish with latte art if you're feeling fancy.
- Total time
- 6 min
- Servings
- 1
- Calories
- 140
- Protein
- 8g
cozysimpleitalianvegetariancreamysilkybreakfastsnack
Ingredients
- 1.5 oz espresso (2 shots or 1–2 oz strong brewed coffee)
- 8 oz whole milk, cold
- ½ tsp sugar or honey
Instructions
- 1
Pour espresso into a mug and stir in sugar if desired.
- 2
Heat milk in a small saucepan over medium heat, stirring, until steaming and tiny bubbles form at the edge, ~3 minutes.
- 3
Whisk milk vigorously for 15–20 seconds to create microfoam.
- 4
Pour steamed milk slowly into the espresso, holding back foam with a spoon; top with remaining foam.
- 5
Serve immediately while hot.
Tools you’ll need
- mug
- small saucepan
- spoon
- whisk
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
