CookSnap is coming soon — Join the waitlist →
Back to recipes

Bun Ga Nuong

Grilled Vietnamese chicken served over cool rice vermicelli with fresh herbs and a tangy fish sauce dressing. A light, aromatic dish that tastes like a restaurant meal but comes together in under 30 minutes.

Total time
25 min
Servings
2
Calories
485
Protein
42g
Bun Ga Nuong
lightfreshvietnamesechickentendercrispyweeknightbowl

Ingredients

  • 1 pound chicken thighs, boneless and skinless
  • 3 tablespoons fish sauce
  • 3 cloves garlic, minced
  • 6 ounces rice vermicelli noodles
  • 1 cup fresh herbs (mint, cilantro, or Vietnamese coriander), chopped
  • 2 tablespoons lime juice

Instructions

  1. 1

    In a small bowl, mix together 2 tablespoons fish sauce, minced garlic, and 1 tablespoon lime juice until combined.

  2. 2

    Pat the chicken thighs dry with paper towels to remove surface moisture, which helps them brown better on the grill.

  3. 3

    Rub the fish sauce–garlic marinade all over both sides of each chicken thigh, coating evenly.

  4. 4

    Preheat a grill or grill pan to medium-high heat for 2 minutes until hot; you should see wisps of smoke rising from the grate.

  5. 5

    Place chicken thighs skin-side down on the hot grill and cook without moving them for 6–7 minutes until the surface is dark golden-brown with charred edges.

  6. 6

    Flip the chicken thighs over and cook for another 5–6 minutes on the other side until they reach an internal temperature of 165°F at the thickest part.

  7. 7

    Transfer the cooked chicken to a cutting board and let it rest for 2 minutes so the juices settle inside the meat.

  8. 8

    While the chicken rests, bring a pot of water to a boil and add the rice vermicelli noodles; cook for 4 minutes until soft but still with a slight chew, then drain and rinse under cool running water.

  9. 9

    In a small bowl, whisk together the remaining 1 tablespoon fish sauce and 1 tablespoon lime juice with 2 tablespoons warm water to make a dressing.

  10. 10

    Divide the cooked rice vermicelli noodles between two bowls, mounding them in the center of each.

  11. 11

    Slice the rested chicken thighs into thin strips, cutting against the grain (perpendicular to the long muscle fibers), and arrange them on top of the noodles in each bowl.

  12. 12

    Scatter the fresh chopped herbs over the chicken and noodles, distributing them evenly across the top.

  13. 13

    Drizzle the fish sauce–lime dressing evenly over both bowls and serve immediately.

Tools you’ll need

  • small mixing bowl
  • paper towels
  • grill or grill pan
  • meat thermometer
  • cutting board
  • chef's knife
  • large pot
  • colander
  • whisk
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.