CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Bruschetta Chicken Skillet

Seared chicken breasts topped with a quick tomato-basil bruschetta mix and melted mozzarella. Fresh, tangy, and ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
42g
Bruschetta Chicken Skillet
quickfreshitaliangluten-freechickencrispytendermelty

Ingredients

  • 2 each (about 6 oz each) chicken breasts, boneless and skinless
  • 2 medium Roma tomatoes
  • ¼ cup, roughly chopped fresh basil
  • ½ cup fresh mozzarella or part-skim mozzarella, shredded
  • 1 tbsp balsamic vinegar
  • 2 cloves garlic, minced
  • 2 tbsp olive oil

Instructions

  1. 1

    Pat chicken breasts dry and season both sides generously with salt and black pepper.

  2. 2

    Heat olive oil in a 10-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Sear chicken 6-7 minutes per side without moving. Edges should look golden; center stays opaque.

  4. 4

    Dice tomatoes and toss with basil, minced garlic, balsamic vinegar, and a pinch of salt.

  5. 5

    Spoon tomato mixture over each chicken breast and top with mozzarella.

  6. 6

    Cover skillet with foil and cook 2-3 minutes until cheese melts and tomatoes soften.

Tools you’ll need

  • 10-inch skillet
  • cutting board
  • chef's knife
  • aluminum foil
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.