CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Bistec Empanizado

Crispy pan-fried breaded beef cutlets with a golden crust and tender interior—a Cuban classic that's ready in under 25 minutes. Serve with lime wedges and your favorite rice and beans.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Bistec Empanizado
comfortcasualcubanbeefcrispytenderweeknightmain-dish

Ingredients

  • ½ lb beef cutlets (thin-sliced round or sirloin)
  • ½ cup all-purpose flour
  • 2 whole eggs
  • ¾ cup panko breadcrumbs
  • 3 tablespoons olive oil
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Place the beef cutlets on a cutting board and pat them dry with paper towels on both sides, so they cook evenly and brown properly.

  2. 2

    Sprinkle salt and pepper over both sides of each cutlet, then place them in a single layer on a clean plate.

  3. 3

    Pour the flour into a shallow bowl (a soup bowl works well), the panko breadcrumbs into a second shallow bowl, and crack the eggs into a third shallow bowl and whisk them with a fork until the yolk and white are fully mixed.

  4. 4

    Heat the olive oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds—the oil should be very hot but not smoking.

  5. 5

    Take one cutlet and press both sides into the flour bowl, coating completely, then tap off the excess flour back into the bowl.

  6. 6

    Dip the floured cutlet into the egg bowl, coating both sides thoroughly, then let excess egg drip back into the bowl.

  7. 7

    Press the egg-coated cutlet onto the panko in the third bowl, pressing gently so the breadcrumbs stick, then flip it and coat the other side the same way.

  8. 8

    Carefully slide the breaded cutlet into the hot oil; it should sizzle loudly on contact, a sign the pan is at the right temperature.

  9. 9

    Cook the first cutlet without moving it for 3 minutes, until the bottom is golden-brown (the color of warm honey) and releases easily from the pan.

  10. 10

    Flip the cutlet with tongs or a spatula and cook the other side for 3 minutes, until it is also golden-brown and the meat feels firm when gently pressed.

  11. 11

    Transfer the cooked cutlet to a clean plate lined with paper towels to drain off excess oil.

  12. 12

    Repeat the flour, egg, and breadcrumb coating steps (steps 5–7) with the second cutlet and cook it in the same skillet for 3 minutes per side, until golden-brown.

  13. 13

    Transfer the second cutlet to the plate with the first one and let both rest for 2 minutes before serving.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • 3 shallow bowls (soup bowls work well)
  • fork
  • paper towels
  • cutting board
  • kitchen tongs or slotted spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.