CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Bibimbap Rice Bowl with Fried Egg

Warm rice bowl topped with a crispy-edged fried egg, gochujang sauce, kimchi, and quick-seared peppers. Mix it all together and eat. Ready in under 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
11g
20-Min Bibimbap Rice Bowl with Fried Egg
satisfyingquickkoreanvegetarianeggscrispycreamyweeknight

Ingredients

  • 2 cups cooked white rice
  • 2 tbsp gochujang (Korean red chili paste)
  • 1 tbsp sesame oil
  • 2 large eggs
  • ¾ cup kimchi, roughly chopped
  • 6 whole shishito peppers

Instructions

  1. 1

    Heat 1 tbsp sesame oil in a skillet over medium-high. When it shimmers, add shishito peppers.

  2. 2

    Cook peppers 3-4 minutes, shaking the pan, until blistered and charred. Transfer to a bowl.

  3. 3

    Crack both eggs into the same skillet. Cook until whites set but yolks jiggle, ~3 minutes.

  4. 4

    Divide warm rice between two bowls. Dollop 1 tbsp gochujang on each, then stir to coat.

  5. 5

    Top each bowl with one fried egg, half the kimchi, and half the charred peppers.

  6. 6

    Serve immediately. Mix everything together before eating.

Tools you’ll need

  • 12-inch skillet
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.