CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Min Bibimbap Bowl with Gochujang Eggs

Cooked rice topped with quick-fried eggs, crispy lettuce wraps, pickled vegetables, and a gochujang-sesame drizzle. Sheet-pan assembly means no simmering—just heat, plate, and drizzle.

Total time
15 min
Servings
2
Calories
485
Protein
12g
15-Min Bibimbap Bowl with Gochujang Eggs
quicksatisfyingkoreanvegetarianeggscrispycreamyweeknight

Ingredients

  • 2 cups cooked white or brown rice
  • 2 large eggs
  • 2 tbsp gochujang (Korean red chili paste)
  • 1 tbsp sesame oil
  • ½ cup pickled onions and jalapeños (store-bought or quick-pickled)
  • 4 leaves romaine or butter lettuce leaves
  • ¾ cup cooked japchae (sweet potato glass noodles) or store-bought

Instructions

  1. 1

    Mix gochujang with 1 tbsp sesame oil and 1 tbsp water until smooth and pourable.

  2. 2

    Heat 1 tbsp neutral oil in a skillet over medium-high until shimmering, ~60 seconds.

  3. 3

    Crack both eggs into the skillet without stirring. Cook until whites set but yolks jiggle, ~3 minutes.

  4. 4

    Divide rice between two bowls and top each with one fried egg.

  5. 5

    Arrange lettuce leaves, japchae, and pickled vegetables around the egg on each bowl.

  6. 6

    Drizzle gochujang sauce over the top and serve immediately.

Tools you’ll need

  • 12-inch skillet or larger
  • small bowl for sauce
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.