CookSnap is coming soon — Join the waitlist →

Berry Galette

A rustic, free-form tart with buttery pastry and juicy mixed berries that bakes in under an hour. No rolling pin or pie tin required—just fold, fill, and bake.

Total time
50 min
Servings
6
Calories
248
Protein
3g
Berry Galette
rusticelegantvegetarianflakycrispyjuicyweekenddessert

Ingredients

  • 1.25 cups all-purpose flour
  • 6 tablespoons cold butter, cubed
  • 3 tablespoons ice water
  • 2.5 cups mixed berries (fresh blueberries, raspberries, blackberries)
  • 3 tablespoons granulated sugar
  • 1 tablespoon cornstarch

Instructions

  1. 1

    Mix flour with 1/4 teaspoon salt in a bowl. Add cold butter cubes and work together with fingertips until mixture looks like coarse breadcrumbs, about 2 minutes.

  2. 2

    Sprinkle ice water over top and toss with a fork until dough just comes together. Shape into a disk, wrap in plastic, and refrigerate 15 minutes.

  3. 3

    Preheat oven to 400°F. Line a large sheet pan with parchment paper.

  4. 4

    Toss berries with sugar and cornstarch in a bowl until coated evenly.

  5. 5

    On parchment, roll or press dough into a 10-inch round about 1/4 inch thick.

  6. 6

    Pile berry mixture onto the center, leaving a 1.5-inch border. Fold edges up and over berries, pleating as you go—don't seal completely.

  7. 7

    Brush exposed dough edge lightly with water. Bake until crust is golden brown and berries bubble at edges, 25–30 minutes.

  8. 8

    Cool on the pan for 10 minutes. Slide onto a wire rack and cool another 10 minutes before serving.

Tools you’ll need

  • medium mixing bowl
  • fork
  • plastic wrap
  • sheet pan
  • parchment paper
  • rolling pin or your hands
  • wire rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.