CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Belgian Mattentaart (Matzentaart)

A classic Belgian custard tart with a crispy pastry shell and silky vanilla custard filling. Baked until golden and served warm or at room temperature for a simple, elegant dessert.

Total time
50 min
Servings
8
Calories
285
Protein
5g
Belgian Mattentaart (Matzentaart)
elegantindulgentbelgianvegetariancreamycrispyflakyweekend

Ingredients

  • 1 sheet (about 9–10 inches) store-bought puff pastry or pie dough
  • 1.5 cups whole milk
  • 4 large egg yolks
  • ⅓ cup granulated sugar
  • 2 tablespoons cornstarch
  • 1 teaspoon vanilla extract
  • ¼ teaspoon ground cinnamon (optional)

Instructions

  1. 1

    Set the oven to 400°F and wait until it finishes heating, about 10 minutes.

  2. 2

    Remove the pastry from the fridge and fit it into a 9-inch tart pan or pie dish, pressing gently into the corners and up the sides until it covers the bottom and edges completely.

  3. 3

    Prick the pastry all over with a fork to prevent it from puffing up unevenly, making 8–10 small holes across the entire surface.

  4. 4

    Pour 1.5 cups of milk into a small saucepan and set it over medium heat until steam rises from the surface and small bubbles appear at the edges, about 3–4 minutes.

  5. 5

    In a medium bowl, whisk together the 4 egg yolks and 0.33 cup sugar until the mixture turns pale yellow and thick, about 2 minutes of continuous whisking.

  6. 6

    Sprinkle the 2 tablespoons of cornstarch over the egg mixture and whisk until no lumps remain and the mixture looks smooth and uniform.

  7. 7

    Slowly pour the hot milk into the egg mixture while whisking constantly to avoid scrambling the eggs—this should take about 1 minute of continuous pouring and whisking.

  8. 8

    Pour the combined mixture back into the saucepan and set it over medium heat, whisking constantly until it thickens into a custard the consistency of thick pudding, about 3–5 minutes.

  9. 9

    Remove from heat and stir in the 1 teaspoon of vanilla extract and the optional cinnamon until fully blended.

  10. 10

    Pour the warm custard into the pastry-lined pan and spread it evenly with a rubber spatula until it reaches the rim, creating a smooth, level surface.

  11. 11

    Place the tart in the preheated oven and bake until the pastry edges turn golden brown and the custard surface looks set but with a slight jiggle in the very center, about 20–25 minutes.

  12. 12

    Remove from the oven and let cool on a wire rack for at least 15 minutes before slicing, allowing the custard to set completely.

Tools you’ll need

  • oven
  • 9-inch tart pan or pie dish
  • fork
  • small saucepan
  • medium mixing bowl
  • whisk
  • rubber spatula
  • wire cooling rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.