CookSnap is coming soon — Join the waitlist →
Back to recipes

Pan-Seared Beef Scaloppine with Mushroom Cream

Thin-pounded beef cutlets seared until golden, finished with a silky mushroom pan sauce. Restaurant-quality dinner in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
32g
Pan-Seared Beef Scaloppine with Mushroom Cream
elegantsatisfyingitalianbeeftendercrispyweeknightdate-night

Ingredients

  • ½ lb beef round or sirloin thin-cut steaks (or thin sliced)
  • 8 oz mushrooms, cremini or button, sliced thin
  • 1 whole shallot, minced
  • ½ cup white wine or dry vermouth
  • ¼ cup heavy cream
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Place beef between plastic wrap and pound thin with a meat mallet until about 1/8 inch thick.

  2. 2

    Season beef generously with salt and pepper on both sides.

  3. 3

    Heat 2 tbsp olive oil in a 12-inch skillet over medium-high until shimmering. Sear beef 60–90 seconds per side until golden; transfer to a plate.

  4. 4

    In the same skillet, sauté mushrooms and shallot until mushrooms release liquid and turn golden, about 5 minutes.

  5. 5

    Pour wine into the pan, scraping up browned bits. Simmer until liquid reduces by half, about 2 minutes.

  6. 6

    Stir in cream and return beef to pan. Heat through for 60 seconds, then serve garnished with fresh parsley.

Tools you’ll need

  • meat mallet
  • plastic wrap
  • 12-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Italian recipes →