CookSnap is coming soon — Join the waitlist →

20-Min Beef Pastitsada

Tender beef simmered in a rich tomato-wine sauce with cinnamon and cloves, tossed with pasta. A Corfiot classic streamlined for weeknight speed.

Total time
20 min
Servings
2
Calories
542
Protein
38g
20-Min Beef Pastitsada
comfortheartygreekbeeftendercreamyweeknightdinner

Ingredients

  • ¾ lb beef chuck or sirloin, diced
  • 8 oz pasta (penne or rigatoni)
  • 14 oz canned diced tomatoes
  • ½ cup red wine
  • 1 whole cinnamon stick
  • 2 whole whole cloves

Instructions

  1. 1

    Bring a large skillet to medium-high. Brown beef in batches, breaking up any clumps, until no pink shows, ~6 minutes total.

  2. 2

    Pour in red wine and scrape the pan bottom. Add tomatoes, cinnamon stick, and cloves, then stir.

  3. 3

    Reduce heat to medium-low and simmer uncovered until sauce thickens and beef is tender, ~8 minutes.

  4. 4

    While sauce simmers, boil pasta in salted water until al dente, then drain and reserve 1/2 cup pasta water.

  5. 5

    Toss drained pasta into the sauce. Add pasta water a splash at a time until it reaches a silky consistency.

  6. 6

    Season with salt and pepper. Remove cinnamon and cloves. Serve hot.

Tools you’ll need

  • large skillet (12-inch or larger)
  • large pot for pasta
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.