CookSnap is coming soon — Join the waitlist →
Back to recipes

Bánh Tráng Nướng

Crispy roasted rice paper crackers with a savory-sweet glaze and toasted sesame seeds. A beloved Vietnamese street snack that's crunchy, addictive, and ready in minutes.

Total time
12 min
Servings
2
Calories
156
Protein
3g
Bánh Tráng Nướng
vietnamesevegetariansnackcrispyglutenfree

Ingredients

  • 6 sheets rice paper (round or square sheets)
  • 3 tablespoons soy sauce
  • 1 tablespoon honey
  • ½ tablespoon sesame oil
  • 2 cloves garlic, minced
  • 2 tablespoons sesame seeds, white
  • 1 stalk scallion, sliced thin

Instructions

  1. 1

    Preheat the oven to 375°F and wait until the indicator light or beep signals it is fully heated, about 8 minutes.

  2. 2

    In a small bowl, whisk together 3 tablespoons soy sauce, 1 tablespoon honey, 0.5 tablespoon sesame oil, and 2 minced garlic cloves until the honey dissolves and the mixture looks uniform.

  3. 3

    Place the 6 rice paper sheets flat on a clean, dry cutting board or work surface in a single layer.

  4. 4

    Using a pastry brush or the back of a spoon, brush the glaze evenly over one side of each rice paper sheet until the surface is wet but not dripping.

  5. 5

    Arrange the glazed rice paper sheets glaze-side-up on a large baking sheet in a single layer, not overlapping.

  6. 6

    Place the baking sheet in the oven and bake until the rice paper is golden brown and very crispy, about 4 minutes—watch carefully so it does not burn.

  7. 7

    Remove the baking sheet from the oven and immediately sprinkle 2 tablespoons sesame seeds evenly over the hot crackers while they are still soft enough for the seeds to stick.

  8. 8

    Return the baking sheet to the oven for 1 minute until the sesame seeds are fragrant and lightly toasted, then remove and let cool for 2 minutes on the sheet.

  9. 9

    Transfer the cooled crackers to a serving plate and scatter the sliced scallion over the top as garnish, then serve immediately while still crispy.

Tools you’ll need

  • oven
  • large baking sheet
  • small bowl
  • whisk
  • pastry brush or spoon
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.