CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Bánh Pia with Mung Bean & Sesame

Crispy Vietnamese pastry pockets filled with sweet mung bean and sesame. These golden, flaky treats are baked until the edges curl and filled with a fragrant, slightly sweet paste that's authentic and deeply satisfying.

Total time
55 min
Servings
4
Calories
285
Protein
6g
Bánh Pia with Mung Bean & Sesame
wholesomeindulgentvietnamesevegetarianflakycrispycrumblyweekend

Ingredients

  • 1 cup dried split mung beans (hulled)
  • 3 tbsp sugar
  • 2 tbsp sesame seeds
  • ½ tsp vanilla extract
  • 1 package (14 oz) vegan puff pastry (thawed if frozen)
  • 1 tbsp olive oil
  • 2 tbsp water
  • ¼ tsp salt
  • 1 tbsp black sesame seeds (optional, for garnish)

Instructions

  1. 1

    Rinse mung beans and add to a pot with 2 cups water. Bring to boil, then simmer 25–30 minutes until very soft.

  2. 2

    Drain beans thoroughly. Mash with a fork until mostly smooth, leaving a few small pieces.

  3. 3

    Stir in sugar, sesame seeds, vanilla, and salt. Mix until the paste is even and fragrant.

  4. 4

    Let filling cool to room temperature, ~10 minutes.

  5. 5

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  6. 6

    Roll out thawed puff pastry on a lightly floured surface. Cut into 3-inch squares.

  7. 7

    Place 1 tsp filling in the center of each square. Fold corner to corner, forming a triangle.

  8. 8

    Press edges firmly with a fork to seal. Brush lightly with olive oil and water mixture.

  9. 9

    Sprinkle with black sesame seeds if using. Bake 15–18 minutes until deep golden and edges curl.

  10. 10

    Cool on the sheet 5 minutes, then transfer to a wire rack. Serve warm or at room temperature.

Tools you’ll need

  • large pot
  • baking sheet
  • parchment paper
  • fork (for mashing and sealing)
  • lightly floured surface or cutting board
  • oven thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.