CookSnap is coming soon — Join the waitlist →
Back to recipes

Asam Laksa with Shrimp

Tangy, aromatic Malaysian fish soup with shrimp and rice noodles. Built on tamarind paste and laksa paste for authentic flavor in under 20 minutes.

Total time
20 min
Servings
2
Calories
280
Protein
22g
Asam Laksa with Shrimp
freshboldmalaysianshrimptendersilkyweeknightdinner

Ingredients

  • 4 cups fish or seafood stock
  • 3 tbsp laksa paste
  • 2 tbsp tamarind paste
  • ½ lb large shrimp, peeled and deveined
  • 6 oz rice noodles
  • 1 whole lime
  • ¼ cup fresh cilantro, chopped
  • 1 whole red Thai chili, thinly sliced (optional)

Instructions

  1. 1

    Bring stock to a boil in a large pot over medium-high heat, about 3 minutes.

  2. 2

    Stir in laksa paste and tamarind paste until smooth. Simmer 2 minutes to bloom flavors.

  3. 3

    Add shrimp. Simmer until opaque and cooked through, 3–4 minutes. Don't overcook.

  4. 4

    While shrimp cooks, soak rice noodles in hot water until softened, about 4 minutes. Drain.

  5. 5

    Squeeze lime juice into the broth. Taste and adjust salt and spice as needed.

  6. 6

    Divide noodles into bowls. Ladle broth and shrimp over top. Garnish with cilantro and chili.

Tools you’ll need

  • large pot (4–5 quart)
  • wooden spoon
  • bowls
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.