CookSnap is coming soon — Join the waitlist →

20-Min Argentine Vegetable Tart

Crispy phyllo crust loaded with caramelized onions, roasted peppers, and creamy cheese — a weeknight take on the classic Buenos Aires tart. Ready in 20 minutes, no homemade pastry required.

Total time
20 min
Servings
4
Calories
285
Protein
9g
20-Min Argentine Vegetable Tart
comfortcasualargentinianvegetariancheesecrispycreamyweeknight

Ingredients

  • 6 sheets phyllo sheets
  • 1 large yellow onion, thinly sliced
  • 1 cup roasted red peppers (jarred or fresh)
  • 1 cup mozzarella or provolone cheese, torn
  • ½ cup cream cheese or ricotta
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Preheat oven to 400°F. Layer phyllo sheets on a sheet pan, lightly brushing each with oil.

  2. 2

    Heat 2 tbsp oil in a skillet over medium. Cook the sliced onion, stirring occasionally, until golden and soft, 8–10 minutes.

  3. 3

    Stir cream cheese into the warm onion until melted and smooth, then fold in the roasted peppers.

  4. 4

    Spread the onion–pepper mixture evenly over the phyllo, leaving a half-inch border.

  5. 5

    Scatter torn mozzarella over the filling, then bake until the crust is golden and cheese melts, 8–10 minutes.

  6. 6

    Remove from oven, scatter fresh parsley over the top, and slice into squares.

Tools you’ll need

  • sheet pan
  • 12-inch skillet
  • spatula
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.