CookSnap is coming soon — Join the waitlist →

Aji de Gallina

A creamy Peruvian chicken stew built on a fragrant walnut and chile paste, finished with potatoes and olives. Rich, warming, and deeply satisfying in under 30 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
38g
Aji de Gallina
comfortheartyperuvianchickencreamytenderweeknightcomfort-food-night

Ingredients

  • 3 cups cooked chicken, shredded
  • ¾ cup walnuts, raw or roasted
  • 2 tablespoons aji amarillo paste or powder
  • 1 pound potatoes, medium waxy or yellow
  • 1 medium onion, yellow or white
  • 1 cup chicken broth or stock
  • ½ cup heavy cream or evaporated milk

Instructions

  1. 1

    Peel the potatoes by holding each one over a cutting board and using a vegetable peeler to remove the thin brown skin in downward strips until the entire surface is pale yellow, rotating as you go.

  2. 2

    Cut each peeled potato lengthwise into halves, then cut each half crosswise into 1/2-inch-thick half-moons so each piece is roughly the size of a thick coin.

  3. 3

    Slice the onion lengthwise from root tip to root base into halves, then place each half flat-side down and slice crosswise into 1/4-inch-thick half-rings.

  4. 4

    Pour 1 tablespoon of olive oil into a large pot and set it over medium-high heat until the oil shimmers and slides quickly when you tilt the pot, about 90 seconds.

  5. 5

    Add the sliced onion to the hot oil and stir constantly for 2 to 3 minutes until the pieces become soft, translucent, and lightly golden at the edges—watch for the color to deepen.

  6. 6

    Add the aji amarillo paste and stir into the onion for 30 seconds until the mixture becomes fragrant and the color darkens slightly, coating the onions evenly.

  7. 7

    Place the walnuts in a small food processor or blender, add 1/4 cup of the chicken broth, and pulse until you have a thick, slightly chunky paste about the consistency of peanut butter.

  8. 8

    Pour the walnut paste into the pot with the onions and aji, then stir for 1 minute until the mixture is evenly combined and no streaks of paste remain.

  9. 9

    Pour in the remaining 3/4 cup chicken broth and the heavy cream, then stir until the sauce is smooth and uniform with no lumps, about 30 seconds.

  10. 10

    Add the potato half-moons to the pot and stir gently to coat them in the sauce, then bring the mixture to a gentle simmer—small bubbles should slowly break the surface.

  11. 11

    Reduce the heat to medium-low and simmer for 10 minutes, stirring occasionally every 2 to 3 minutes, until the potatoes are tender when pierced with a fork.

  12. 12

    Stir in the shredded chicken and cook for 2 more minutes, stirring gently, until the chicken is heated through and blended with the sauce.

  13. 13

    Taste the stew and add salt and pepper to your liking, starting with 1/4 teaspoon of each and adjusting from there.

  14. 14

    Ladle the stew into bowls, ensuring each bowl has equal amounts of sauce, potatoes, and chicken, then serve while hot.

Tools you’ll need

  • vegetable peeler
  • cutting board
  • chef's knife
  • large pot (6-quart capacity)
  • wooden spoon for stirring
  • small food processor or blender
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.