CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Spring Rolls

Rice paper wraps filled with shredded cabbage, carrots, and fresh herbs, then pan-fried until golden and crispy. Serve with a tangy dipping sauce for a restaurant-quality appetizer or light dinner.

Total time
20 min
Servings
2
Calories
145
Protein
2g
Crispy Spring Rolls
freshcasualvietnamesevegetariandairy-freecrispytenderBread

Ingredients

  • 8 wrappers rice paper wrappers (8-inch rounds)
  • 2 cups napa cabbage, shredded
  • 1 medium carrot, shredded
  • ½ cup fresh cilantro and mint, chopped
  • 2 tbsp fish sauce
  • 1.5 tbsp lime juice
  • 1 tsp sugar

Instructions

  1. 1

    Whisk fish sauce, lime juice, sugar, and 3 tbsp water until sugar dissolves.

  2. 2

    Dip one rice paper in warm water for 5 seconds until pliable, then place flat on a clean surface.

  3. 3

    Layer cabbage, carrot, and herbs in the center third of the wrapper, leaving 2 inches at both ends.

  4. 4

    Fold the bottom third up, tuck in the sides, then roll tightly away from you until sealed.

  5. 5

    Repeat steps 2–4 with remaining wrappers. Heat oil in a 10-inch skillet over medium-high until shimmering.

  6. 6

    Working in batches, fry rolls 2 minutes per side until golden and crispy, then transfer to a plate.

  7. 7

    Serve hot with the dipping sauce on the side.

Tools you’ll need

  • shallow bowl or pie dish
  • cutting board
  • 10-inch nonstick skillet
  • wooden spoon or tongs
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.