CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Egg Curry

Creamy tomato-coconut sauce spiked with ginger, garlic, and warm spices, studded with hard-boiled eggs. Restaurant-quality curry that actually fits on a weeknight.

Total time
20 min
Servings
4
Calories
285
Protein
14g
20-Min Egg Curry
comfortindianvegetarianeggscreamytenderweeknightcurry

Ingredients

  • 8 whole eggs, hard-boiled and halved
  • 1 can (14 oz) coconut milk
  • 1 can (14.5 oz) crushed tomatoes
  • 2 tbsp ginger-garlic paste
  • 1.5 tsp garam masala
  • 1 medium onion, diced
  • 1 whole green chili, minced (or 1/2 tsp cayenne)

Instructions

  1. 1

    Heat 2 tbsp oil in a 12-inch skillet over medium-high. Add diced onion and cook for 3 minutes, stirring, until softened and starting to brown.

  2. 2

    Stir in ginger-garlic paste and minced chili, cook for 30 seconds until fragrant, then add garam masala and stir for 15 seconds.

  3. 3

    Pour in crushed tomatoes and coconut milk. Stir well and bring to a gentle simmer, then reduce heat to medium and simmer 5 minutes.

  4. 4

    Gently slide egg halves into the curry. Simmer 3 minutes until eggs are warmed through and sauce is glossy.

  5. 5

    Taste and season with salt and pepper. Serve over steamed rice or with naan.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • pot for boiling eggs (optional; use pre-boiled or store-bought)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.