CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Min Bibimbap Rice Bowl

Warm rice topped with crispy fried egg, quick-pickled veggies, and spicy gochujang sauce. A one-pan Korean classic that feels fancy but takes less time than ordering.

Total time
15 min
Servings
2
Calories
385
Protein
9g
15-Min Bibimbap Rice Bowl
quicksatisfyingkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups cooked rice (warm)
  • 3 tbsp gochujang (Korean red chili paste)
  • 2 whole eggs
  • 1 whole cucumber
  • 1 whole carrot
  • 1 tbsp sesame seeds

Instructions

  1. 1

    Slice cucumber and carrot into thin matchsticks.

  2. 2

    Mix gochujang with 1 tbsp water and 0.5 tbsp white vinegar until smooth and pourable.

  3. 3

    Heat 1 tbsp oil in a skillet over medium-high until shimmering.

  4. 4

    Crack eggs into the skillet and fry until whites set but yolks still jiggle, ~3 minutes.

  5. 5

    Divide warm rice between two bowls. Top each with cucumber, carrot, and one fried egg.

  6. 6

    Drizzle gochujang sauce over the top. Sprinkle sesame seeds and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • 2 serving bowls
  • knife
  • cutting board
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.