CookSnap is coming soon — Join the waitlist →
Back to recipes

10-Min Bibimbap Bowl with Crispy Egg

Warm rice topped with quick-sautéed vegetables, a fried egg, and gochujang-sesame sauce — the ultimate one-skillet Korean comfort bowl. Ready in 10 minutes.

Total time
10 min
Servings
2
Calories
385
Protein
10g
10-Min Bibimbap Bowl with Crispy Egg
quicksatisfyingkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups cooked rice
  • 1 small zucchini, julienned
  • 1 small carrot, julienned
  • 1.5 cups spinach, fresh
  • 2 tbsp gochujang (Korean chili paste)
  • 1.5 tbsp sesame oil
  • 2 large eggs

Instructions

  1. 1

    Whisk gochujang and sesame oil with 1 tbsp water until smooth.

  2. 2

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering.

  3. 3

    Add zucchini and carrot, toss constantly until just softened, about 3 minutes.

  4. 4

    Pile spinach on top and stir for 30 seconds until wilted, then push all vegetables to the skillet edge.

  5. 5

    Add remaining 0.5 tbsp oil to center. Crack both eggs into the space and fry until whites set but yolks jiggle, about 3 minutes.

  6. 6

    Divide rice between bowls, top with vegetable mix and fried egg, drizzle gochujang sauce over all.

Tools you’ll need

  • large 12-inch skillet
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.