CookSnap is coming soon — Join the waitlist →
Back to recipes

Veggie Kimbap Rolls

Crispy rice rolls packed with pickled radish, cucumber, egg, and spinach—no cooking required except steaming the rice. Slice, dip in gochujang mayo, and eat.

Total time
20 min
Servings
2
Calories
310
Protein
8g
Veggie Kimbap Rolls
freshcasualkoreanvegetarianeggscrispytenderweeknight

Ingredients

  • 2 cups short-grain white rice, cooked and cooled
  • 2 sheets nori (seaweed sheets)
  • ½ cup pickled radish (danmuji), cut into thin strips
  • ½ large cucumber, cut into thin matchsticks
  • 1 whole egg, beaten and cooked into a thin omelette, sliced into strips
  • ½ cup fresh spinach (or sesame spinach from deli section)
  • 2 tbsp gochujang (Korean red chili paste)

Instructions

  1. 1

    Heat oil in a skillet over medium. Pour beaten egg in, tilt to spread thin, cook 90 seconds per side until set. Slide onto a cutting board and slice into strips.

  2. 2

    Place nori on a bamboo mat shiny-side down. Spread a thin layer of cooled rice across the nori, leaving a 0.5-inch strip at the top.

  3. 3

    Arrange a line of pickled radish, cucumber, egg, and spinach horizontally across the rice about 2 inches from the bottom.

  4. 4

    Roll the mat toward you, pressing gently as you go, until the nori wraps around and seals at the top strip.

  5. 5

    Let the roll rest seam-side down for 30 seconds. Using a wet, sharp knife, slice the roll into 6–8 pieces with one clean motion per slice.

  6. 6

    Stir gochujang with 1 tbsp water to make a dipping sauce. Serve rolls with sauce on the side.

Tools you’ll need

  • 12-inch skillet
  • bamboo sushi mat
  • sharp knife (8-inch chef's knife preferred)
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.