CookSnap is coming soon — Join the waitlist →
Back to recipes

10-Min Mochi with Sweet Filling

Chewy, pillow-soft mochi made from sweet rice flour and filled with your favorite jam, nutella, or red bean paste. Ready in 10 minutes—no oven, no steam basket needed.

Total time
10 min
Servings
4
Calories
156
Protein
1g
10-Min Mochi with Sweet Filling
indulgentquickjapanesevegetariandairy-freechewysoftsnack

Ingredients

  • 1 cup sweet rice flour (mochiko)
  • ½ cup granulated sugar
  • 1 cup water
  • 3 tbsp cornstarch or potato starch
  • ½ cup jam, nutella, red bean paste, or sweetened filling

Instructions

  1. 1

    Mix sweet rice flour, sugar, and water in a microwave-safe bowl until smooth and lump-free.

  2. 2

    Microwave on high for 2 minutes, stir well, then microwave another 90 seconds until thick and translucent.

  3. 3

    Dust a cutting board generously with cornstarch, then spread the hot mochi onto it.

  4. 4

    Cool for 2 minutes, dust the top with more cornstarch, then cut into 8 squares.

  5. 5

    Gently flatten each square, add 1 teaspoon filling to the center, then fold edges up and pinch to seal.

  6. 6

    Serve immediately or at room temperature. Store in an airtight container up to 2 days.

Tools you’ll need

  • microwave-safe bowl
  • microwave
  • wooden spoon or spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Japanese recipes →