CookSnap is coming soon — Join the waitlist →
Back to recipes

Zserbó: Apricot & Walnut Bars

Hungarian layered bar with buttery base, jammy apricot middle, and walnut topping — no mixer needed, all mixed by hand and baked in one pan.

Total time
25 min
Servings
6
Calories
385
Protein
6g
Zserbó: Apricot & Walnut Bars
cozyindulgenthungarianvegetariancrispychewyweeknightdessert

Ingredients

  • 1.5 cups all-purpose flour
  • ½ cup butter, softened
  • ¾ cup apricot jam
  • 1 cup walnuts, chopped
  • 1 whole egg
  • ¼ cup granulated sugar
  • ½ tsp vanilla extract

Instructions

  1. 1

    Preheat oven to 350°F. Line an 8×8 baking pan with parchment paper.

  2. 2

    Mix butter, sugar, and vanilla in a bowl until pale and fluffy, about 2 minutes by hand.

  3. 3

    Stir in flour and 0.5 cup walnuts until crumbly. Press half into the pan to form base.

  4. 4

    Spread jam evenly over crust. Whisk egg, then mix with remaining 0.5 cup walnuts and sugar.

  5. 5

    Dollop walnut mixture over jam and spread gently to cover. Bake until golden, 12–14 minutes.

  6. 6

    Cool in pan 5 minutes, then slice into 6 bars. Serve warm or at room temperature.

Tools you’ll need

  • 8×8 baking pan
  • parchment paper
  • mixing bowl
  • whisk
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.