CookSnap is coming soon — Join the waitlist →

Yunnan Er Kuai with Pork

Soft, chewy rice cakes topped with crispy pork, soy-vinegar sauce, and fresh herbs. A classic Yunnan street food that's quick and deeply satisfying.

Total time
25 min
Servings
4
Calories
385
Protein
16g
Yunnan Er Kuai with Pork
casualcomfortchineseporkchewycrispyweeknightmain-dish

Ingredients

  • 6 oz pork shoulder or belly, diced into 1/2-inch pieces
  • 14 oz fresh er kuai rice cakes (or glutinous rice cakes)
  • 3 tbsp soy sauce
  • 1.5 tbsp black vinegar (or rice vinegar)
  • 3 clove garlic cloves, minced
  • ½ cup scallions, chopped
  • 1 tsp chili oil or hot sauce

Instructions

  1. 1

    Mix soy sauce, vinegar, and chili oil in a small bowl. Set aside.

  2. 2

    Heat oil in a large skillet over medium-high until shimmering, ~90 seconds.

  3. 3

    Add diced pork and cook, stirring occasionally, until browned and cooked through, ~8 minutes.

  4. 4

    Add minced garlic and cook for 30 seconds until fragrant.

  5. 5

    Add er kuai cakes and toss gently until warmed through and slightly softened, ~3 minutes.

  6. 6

    Pour sauce over the top and toss to coat evenly for 1 minute.

  7. 7

    Divide into bowls and top with chopped scallions. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • small mixing bowl
  • spoon or spatula for tossing

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.