CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Whipped Ricotta Toast with Hot Honey

Creamy whipped ricotta spread on toasted bread, drizzled with spicy hot honey and fresh herbs. A breakfast or snack that tastes fancy but takes 10 minutes.

Total time
10 min
Servings
2
Calories
285
Protein
12g
Whipped Ricotta Toast with Hot Honey
simpleelegantitalianvegetariancheesecreamycrispyweeknight

Ingredients

  • 1 cup ricotta cheese
  • 4 slices bread (sourdough or country loaf)
  • 3 tbsp hot honey (or honey + chili flakes)
  • ½ whole lemon (zest + juice)
  • 2 tbsp fresh herbs (basil, oregano, or parsley, chopped)
  • 1 pinch flake sea salt

Instructions

  1. 1

    Toast bread until golden and crispy, about 2–3 minutes per side.

  2. 2

    Whisk ricotta with lemon zest, lemon juice, and a pinch of salt until light and fluffy.

  3. 3

    Spread whipped ricotta generously on each warm toast slice.

  4. 4

    Drizzle hot honey over the ricotta until it pools slightly at the edges.

  5. 5

    Scatter fresh herbs and flake salt on top. Serve immediately while bread is still warm.

Tools you’ll need

  • toaster or toaster oven
  • whisk or fork
  • small bowl
  • plate or cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.