Whipped Ricotta Toast with Hot Honey
Creamy whipped ricotta spread on toasted bread, drizzled with spicy hot honey and fresh herbs. A breakfast or snack that tastes fancy but takes 10 minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 285
- Protein
- 12g
simpleelegantitalianvegetariancheesecreamycrispyweeknight
Ingredients
- 1 cup ricotta cheese
- 4 slices bread (sourdough or country loaf)
- 3 tbsp hot honey (or honey + chili flakes)
- ½ whole lemon (zest + juice)
- 2 tbsp fresh herbs (basil, oregano, or parsley, chopped)
- 1 pinch flake sea salt
Instructions
- 1
Toast bread until golden and crispy, about 2–3 minutes per side.
- 2
Whisk ricotta with lemon zest, lemon juice, and a pinch of salt until light and fluffy.
- 3
Spread whipped ricotta generously on each warm toast slice.
- 4
Drizzle hot honey over the ricotta until it pools slightly at the edges.
- 5
Scatter fresh herbs and flake salt on top. Serve immediately while bread is still warm.
Tools you’ll need
- toaster or toaster oven
- whisk or fork
- small bowl
- plate or cutting board
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
