Warm Pain au Chocolat with Coffee
Store-bought pain au chocolat warmed until crispy outside and melty inside, paired with strong French coffee. Pure indulgence in 10 minutes, no baking required.
- Total time
- 10 min
- Servings
- 2
- Calories
- 320
- Protein
- 6g
indulgentcozyfrenchvegetariancrispyflakymeltybreakfast
Ingredients
- 2 pastries pain au chocolat
- ½ cup whole milk
- 2 tbsp ground coffee (dark roast)
- 1 tbsp sugar
- 1 tsp butter
Instructions
- 1
Preheat oven to 350°F.
- 2
Place pain au chocolat on a baking sheet. Bake 6–8 minutes until the edges are golden and chocolate peeks through.
- 3
Heat milk in a small saucepan over medium until steaming, about 2 minutes.
- 4
Whisk in ground coffee and sugar. Strain through a fine-mesh sieve into two cups.
- 5
Top each cup with butter and stir until melted. Serve immediately with warm pastries.
Tools you’ll need
- oven
- baking sheet
- small saucepan
- whisk
- fine-mesh sieve
- two mugs or cups
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
