CookSnap is coming soon — Join the waitlist →
Back to recipes

Walnut Sauce (Salsa di Noci)

A silky Ligurian walnut sauce made with just walnuts, garlic, bread, and cream. Toss with pansotti or any fresh pasta for an elegant, nutty finish.

Total time
10 min
Servings
4
Calories
420
Protein
12g
Walnut Sauce (Salsa di Noci)
elegantsimpleitalianvegetarianvegetariansilkycreamyweeknight

Ingredients

  • 1.5 cups walnuts, raw or lightly toasted
  • 1 whole garlic clove, minced
  • ¼ cup fresh bread crumbs (from day-old bread)
  • ½ cup heavy cream
  • ¼ cup parmesan cheese, finely grated
  • 0 salt and black pepper to taste

Instructions

  1. 1

    Toast walnuts in a dry skillet over medium heat, stirring often, until fragrant and lightly colored, ~3 minutes.

  2. 2

    Transfer warm walnuts to a food processor. Add garlic, bread crumbs, cream, and parmesan.

  3. 3

    Pulse until the sauce reaches a silky, paste-like consistency—small flecks of walnut visible, no chunks.

  4. 4

    Taste and adjust salt and pepper. If sauce is too thick, thin with a tablespoon of warm pasta water or cream.

  5. 5

    Serve warm or at room temperature with fresh pasta, drizzling extra cream if desired.

Tools you’ll need

  • 12-inch skillet or sauté pan
  • food processor or blender
  • wooden spoon
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.