Vietnamese Ginger Chicken Soup
Lau ga—a comforting Vietnamese chicken and ginger broth—made fast with rotisserie chicken and a single pot. Bright, aromatic, and ready in 15 minutes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 285
- Protein
- 38g
comfortcozyvietnamesechickentendersilkyweeknightcomfort-food-night
Ingredients
- 2 cups rotisserie chicken, shredded
- 4 cups chicken broth
- 2 tbsp fresh ginger, sliced thin
- 3 whole scallions, chopped
- 1 tbsp fish sauce
- ½ whole lime (juiced)
Instructions
- 1
Pour broth into a pot and bring to a simmer over medium-high heat.
- 2
Add ginger slices and simmer for 2 minutes until fragrant.
- 3
Stir in rotisserie chicken, fish sauce, and half the scallions.
- 4
Simmer 2 minutes more until chicken is heated through.
- 5
Squeeze lime juice into the pot and taste—adjust fish sauce or salt.
- 6
Ladle into bowls and top with remaining scallions. Serve hot.
Tools you’ll need
- 4-quart pot
- cutting board
- knife
- spoon
- ladle
- bowls
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
