CookSnap is coming soon — Join the waitlist →
Back to recipes

Vietnamese Chicken Noodle Salad

Fresh rice noodles tossed with shredded chicken, crisp vegetables, and a bright lime-fish sauce dressing. Ready in under 20 minutes—a light, herbaceous summer meal.

Total time
18 min
Servings
2
Calories
385
Protein
32g
Vietnamese Chicken Noodle Salad
freshlightvietnamesechickentendercrispyweeknightsummer

Ingredients

  • 8 oz cooked chicken breast, shredded
  • 6 oz rice noodles, 1/8-inch wide
  • 1 medium cucumber, julienned
  • 2 medium carrots, julienned
  • 1 whole lime (juiced)
  • 2 tbsp fish sauce
  • ½ cup fresh herbs (mint, cilantro, or basil, chopped)
  • ¼ cup crushed peanuts or roasted cashews

Instructions

  1. 1

    Bring a pot of water to a boil. Add rice noodles and cook until tender, ~4 minutes.

  2. 2

    Drain noodles and rinse under cold water until cool. Shake off excess water.

  3. 3

    Julienne the cucumber and carrots into thin matchsticks, ~2 inches long.

  4. 4

    In a small bowl, whisk together lime juice and fish sauce until combined.

  5. 5

    Place noodles in a serving bowl. Top with chicken, cucumber, and carrots.

  6. 6

    Pour dressing over the salad and toss until evenly coated.

  7. 7

    Scatter fresh herbs and nuts on top. Serve immediately.

Tools you’ll need

  • large pot
  • colander
  • cutting board
  • sharp knife
  • small bowl
  • whisk
  • serving bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.