CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Urojo Soup

Tanzania's beloved street-food soup: a vibrant tangle of fried potatoes, chickpeas, tomatoes, and hot sauce bound with eggs. Finish with crispy chips for contrast and pure comfort.

Total time
45 min
Servings
4
Calories
420
Protein
14g
Urojo Soup
comfortcasualtanzanianvegetarianchickpeaseggscreamycrunchy

Ingredients

  • 2 whole potatoes, medium
  • 1 can (15 oz) canned chickpeas, drained
  • 3 medium tomatoes, diced
  • 4 cups vegetable broth
  • 3 tbsp hot sauce (adjust to taste)
  • 3 whole eggs
  • 1 cup potato chips or french fries (fried)
  • 3 tbsp olive oil
  • 1 to taste salt and pepper

Instructions

  1. 1

    Cut potatoes into 1-inch cubes. Slice tomatoes into chunks. Set aside.

  2. 2

    Heat 2 tbsp oil in a large pot over medium-high until shimmering.

  3. 3

    Add potato cubes, stirring occasionally, until golden and crispy outside, ~10 minutes.

  4. 4

    Pour in broth and bring to a simmer. Add chickpeas and tomatoes.

  5. 5

    Simmer 8 minutes until potatoes are tender. Stir in hot sauce.

  6. 6

    Whisk eggs in a bowl. Slowly pour into simmering soup while stirring gently until ribbons form, ~2 minutes.

  7. 7

    Heat remaining 1 tbsp oil in a skillet. Fry potato chips until golden if not store-bought fried.

  8. 8

    Taste soup and adjust salt, pepper, and hot sauce. Ladle into bowls.

  9. 9

    Top each bowl with crispy chips and serve immediately.

Tools you’ll need

  • large pot
  • cutting board
  • chef's knife
  • wooden spoon
  • whisk
  • medium skillet
  • ladle
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.