Turkey Avocado Croissant Club
Buttery croissant layered with sliced turkey, creamy avocado, crisp bacon, and fresh greens. A California-style handheld that feels fancy but takes five minutes.
- Total time
- 5 min
- Servings
- 1
- Calories
- 520
- Protein
- 22g
casualelegantcalifornianturkeycrispycreamyflakyweeknight
Ingredients
- 1 whole croissant, large
- 3 oz sliced turkey breast, deli-quality
- ½ whole avocado, ripe
- 2 whole bacon slices, cooked
- 1 small handful fresh greens (arugula or lettuce)
- 1 tbsp mayonnaise
Instructions
- 1
Split the croissant lengthwise and lightly toast the cut sides if desired.
- 2
Spread mayonnaise on both cut sides of the croissant.
- 3
Layer turkey, bacon, and fresh greens on the bottom half.
- 4
Slice the avocado and fan it on top of the greens.
- 5
Close the croissant and slice diagonally. Serve immediately.
Tools you’ll need
- serrated bread knife
- small spreading knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
