CookSnap is coming soon — Join the waitlist →
Back to recipes

Torta Salata with Greens and Cheese

A savory Italian vegetable tart with spinach, ricotta, and mozzarella baked in flaky pastry. Light enough for lunch, hearty enough for dinner.

Total time
45 min
Servings
4
Calories
380
Protein
14g
Torta Salata with Greens and Cheese
casualwholesomeitalianvegetariancheeseflakycreamyweeknight

Ingredients

  • 1.5 cups all-purpose flour
  • ½ cup cold butter, cubed
  • 1 pinch salt and pepper to taste
  • 4 tbsp ice water
  • 6 cups fresh spinach, packed
  • 1 cup ricotta cheese
  • ¾ cup mozzarella, shredded
  • ¼ cup Pecorino Romano, grated
  • 1 whole egg

Instructions

  1. 1

    Mix flour and salt in a bowl. Cut in cold butter until mixture resembles breadcrumbs.

  2. 2

    Add ice water 1 tbsp at a time, stirring gently, until dough just comes together.

  3. 3

    Shape dough into a disk, wrap in plastic, and chill 15 minutes.

  4. 4

    Preheat oven to 400°F (200°C). Roll chilled dough to fit a 9-inch pie dish.

  5. 5

    Wilt spinach in a skillet over medium heat, 1–2 minutes. Squeeze out excess moisture.

  6. 6

    Mix ricotta, mozzarella, Pecoriano, egg, salt, and pepper in a bowl until combined.

  7. 7

    Fold cooled spinach into cheese mixture. Spread into pie crust evenly.

  8. 8

    Bake 25–30 minutes until crust is golden and filling is set. Cool 5 minutes.

  9. 9

    Slice into wedges and serve warm or room temperature.

Tools you’ll need

  • mixing bowl
  • 9-inch pie dish
  • rolling pin
  • 10-inch skillet
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.