CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Tomato Grilled Cheese

Crispy buttered bread hugs melted cheese and fresh tomato slices in this lunchbox classic. A skillet brings it together in under 10 minutes.

Total time
10 min
Servings
1
Calories
420
Protein
14g
Tomato Grilled Cheese
comfortquickamericanvegetariancrispymeltyweeknightlunch

Ingredients

  • 2 slices bread, sliced (white, whole wheat, or sourdough)
  • 1 tablespoon butter
  • 2 slices cheddar or American cheese
  • 1 medium tomato
  • ¼ teaspoon salt and pepper

Instructions

  1. 1

    Place a 10-inch skillet on the stove and turn heat to medium. Wait 30 seconds for the pan to warm up.

  2. 2

    While the pan heats, cut the tomato lengthwise in half, then lay each half cut-side down and slice crosswise into 1/4-inch-thick slices.

  3. 3

    Spread 0.5 tablespoon butter across one side of the first bread slice, covering it completely so the surface looks wet and shiny.

  4. 4

    Place the buttered slice into the skillet buttered-side down, so you hear a gentle sizzle immediately.

  5. 5

    Lay one cheese slice on top of the bread in the skillet, centering it so it covers the entire slice.

  6. 6

    Arrange the tomato slices in a single layer on top of the cheese, then sprinkle with a pinch of salt and pepper.

  7. 7

    Place the second cheese slice on top of the tomato layer, pressing down gently so all layers stay together.

  8. 8

    Spread 0.5 tablespoon butter across one side of the second bread slice until the surface looks wet and shiny.

  9. 9

    Place the second slice on top of the sandwich with the buttered side facing up, creating a sandwich tower in the pan.

  10. 10

    Cook for 2 to 3 minutes, watching the pan, until the bottom bread turns the color of warm honey with slightly darker edges.

  11. 11

    Slide a thin spatula under the sandwich and flip it to the other side in one smooth motion, so the uncooked side now faces the pan.

  12. 12

    Cook for another 2 to 3 minutes until the second side turns the same golden-honey color and the cheese inside feels melty and soft when you press the top lightly.

  13. 13

    Slide the sandwich onto a cutting board or plate using the spatula. Let it sit for 1 minute so the cheese sets slightly and won't ooze out.

  14. 14

    Cut the sandwich diagonally in half so you create two triangles, then serve immediately while still warm.

Tools you’ll need

  • 10-inch skillet
  • spatula (thin metal or silicone)
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.