CookSnap is coming soon — Join the waitlist →
Back to recipes

Tomato Egg Skillet with Warm Flatbread

Eggs poached in garlicky tomato sauce — a Mediterranean breakfast that cooks in one pan. Serve with warm flatbread for dipping into the silky, spiced sauce.

Total time
15 min
Servings
2
Calories
285
Protein
12g
Tomato Egg Skillet with Warm Flatbread
comfortfreshmediterraneanvegetarianeggssilkytenderweeknight

Ingredients

  • 2 tbsp olive oil
  • 2 clove garlic cloves, minced
  • 1 can (14 oz) canned crushed tomatoes
  • 4 large eggs
  • 2 piece flatbread
  • 2 tbsp fresh parsley or cilantro, chopped

Instructions

  1. 1

    Heat oil in a 10-inch skillet over medium-high until it shimmers, ~90 seconds.

  2. 2

    Add garlic and cook for 30 seconds until fragrant, then add crushed tomatoes.

  3. 3

    Simmer sauce for 3 minutes, then season with salt and black pepper to taste.

  4. 4

    Make 4 small wells in the sauce and crack an egg into each; cover with a lid.

  5. 5

    Cook until whites set but yolks still jiggle, 4–5 minutes, then remove from heat.

  6. 6

    Warm flatbread in a dry pan or over a flame, then scatter parsley over eggs and serve.

Tools you’ll need

  • 10-inch skillet with lid
  • wooden spoon or spatula
  • small knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.